PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA016106-PA
Common NameOsI_15308
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 71aa    MW: 7942.51 Da    PI: 10.9467
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA016106-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.92.4e-27959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      kri+n++nrqvtfskRr g++KKA EL +LCda+v +i+fs tg+ly++ss
  BGIOSGA016106-PA  9 KRIDNTMNRQVTFSKRRGGLMKKARELAILCDADVGLIVFSCTGRLYDFSS 59
                      79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.9E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.712161IPR002100Transcription factor, MADS-box
CDDcd002651.31E-36266No hitNo description
SuperFamilySSF554556.02E-28261IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 71 aa     Download sequence    Send to blast
MGRGKIAIKR IDNTMNRQVT FSKRRGGLMK KARELAILCD ADVGLIVFSC TGRLYDFSSS  60
RLVIIIVDPL L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-18160160Myocyte-specific enhancer factor 2B
1tqe_Q1e-18160160Myocyte-specific enhancer factor 2B
1tqe_R1e-18160160Myocyte-specific enhancer factor 2B
1tqe_S1e-18160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.542652e-99callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329881362e-99
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL7316091e-117AL731609.2 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0079M09, complete sequence.
GenBankAP0149601e-117AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635120.11e-36PREDICTED: MADS-box transcription factor 25
SwissprotQ84NC51e-38MAD25_ORYSJ; MADS-box transcription factor 25
TrEMBLB8AS741e-44B8AS74_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA016106-PA4e-44(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.18e-33AGAMOUS-like 16